Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BQ047786.1 | internal | 194 | 583-2(-) |
Amino Acid sequence : | |||
CNYCDKVVSGFNRLKHHLGGIRGDVTPCLEAPIVVKEALEAELLDKKSGNLIKEVGQLHRPNLLLKRNRCPRDGDGEPSKTDLTQSSESANKKHNGVNSKKAGSCVVDSSSQEISKSIGK FFYEAGIDFDAIRSPSFQRMVKATLDPGQTIKFPSCQELKGWILQDAVKEMQQYVMEIRNSWPSHRVQRLARWL | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 21,752.627 | ||
Theoretical pI: | 9.138 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
Instability index: | 45.854 | ||
aromaticity | 0.062 | ||
GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.258 | ||
sheet | 0.216 |