Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB816832.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
GPPTSSHTLALFDDPTNLDLKLVSPANTATSTTSCYQSMCTLDKVKSALDRAWRDPPPSTASSCSLSGKKRPSPTTALSCSSDCTSTAIDQNTTTLQNGNGNGNGNGCLMVAAACPCCLL YVLISKANPKCPKCNTFIPSPVTSLIPKKPK | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 15,696.790 | ||
Theoretical pI: | 8.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 9105 | ||
Instability index: | 45.597 | ||
aromaticity | 0.033 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.192 | ||
turn | 0.351 | ||
sheet | 0.192 |