Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB816857.1 | internal | 169 | 1-507(+) |
Amino Acid sequence : | |||
GSKYTPKGQGKGFFRYGNQLNKDRLNEMSKGPRADGAFKNELPYGSFKLAVKGQGLPRDVSNIEEKNNVPVCPAKEQYNKEDFPENFKDAKFFVIKSYSEDDVHRSVKYSVWSSTPNGNK KLNEAYQEAQAKSGDCPVFLLFSVNGSGQFVGLAEMVGPVDFNKTVDFW | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,924.953 | ||
Theoretical pI: | 8.738 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 26.680 | ||
aromaticity | 0.130 | ||
GRAVY | -0.764 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.314 | ||
sheet | 0.183 |