Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB816877.1 | internal | 175 | 2-526(+) |
Amino Acid sequence : | |||
GIQVTTQINCQSRKSYKNKILFSKSLCHQTNLRNMSLIPSFFGGRRSNNFDPFSLDVWDPLQGFPFINNNSNFSSPSSWALSNRDTSAFVNARIDWKETPEAHVFKADLPGIKKEEVKVE VEDGRVLQISGERSREQDEKTDTWHRVERSSGRFQRRFRLPENVKMDEVKASMDN | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 11,057.801 | ||
Theoretical pI: | 8.277 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 55.491 | ||
aromaticity | 0.030 | ||
GRAVY | 0.160 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.267 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB816877.1 | 5prime_partial | 147 | 528-85(-) |
Amino Acid sequence : | |||
PLSMEALTSSIFTFSGSLNLLWNRPLLRSTRCHVSVFSSCSRLRSPLICSTLPSSTSTFTSSFLIPGRSALNTCASGVSFQSIRALTNAEVSLLDRAQEDGDEKLLLLLIKGNPCNGSQT SRENGSKLLLRRPPKKLGISDMFLRFV* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 11,057.801 | ||
Theoretical pI: | 8.277 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 55.491 | ||
aromaticity | 0.030 | ||
GRAVY | 0.160 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.267 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB816877.1 | 5prime_partial | 101 | 526-221(-) |
Amino Acid sequence : | |||
IVHGGLNLIHLHVLRKPEPPLESSAATLDTVPCVGLFILFTAPLTANLQHPSVLHLNLHLLLLDSRQVRLEHVRLRGLLPVDPGVDERGGVPVGQSPRRWG* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,057.801 | ||
Theoretical pI: | 8.277 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 55.491 | ||
aromaticity | 0.030 | ||
GRAVY | 0.160 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.267 | ||
sheet | 0.287 |