Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB816900.1 | internal | 117 | 3-353(+) |
Amino Acid sequence : | |||
GAVDSPSERGIPTLITWNQGGSNVIVEGTWDNWASKKTLQRAGKDHFLLLVLPPGIFHYRFIVDGKERHMPDLPVVTDEIGNICNVLDVHDYVPESLGSISEFETPPSPDSSYAQGF | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,892.260 | ||
Theoretical pI: | 4.704 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 43.633 | ||
aromaticity | 0.094 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.308 | ||
sheet | 0.179 |