| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB816929.1 | internal | 121 | 3-365(+) |
Amino Acid sequence : | |||
| YILIPMQTVKSLCGHRDYSFASAWHPDGMTFATGNQDKTCRIWDIRNLSKSVEVLKGNLGAIRSIRYSSDGRYMAMSEPAHFVHVFDAKNGYEVEQEIDFFGEISGISFSPDTEPLFIGV W | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,701.319 | ||
| Theoretical pI: | 5.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 32.039 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.256 | ||
| sheet | 0.198 | ||