Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB816929.1 | internal | 121 | 3-365(+) |
Amino Acid sequence : | |||
YILIPMQTVKSLCGHRDYSFASAWHPDGMTFATGNQDKTCRIWDIRNLSKSVEVLKGNLGAIRSIRYSSDGRYMAMSEPAHFVHVFDAKNGYEVEQEIDFFGEISGISFSPDTEPLFIGV W | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,701.319 | ||
Theoretical pI: | 5.459 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 32.039 | ||
aromaticity | 0.132 | ||
GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.256 | ||
sheet | 0.198 |