| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB816942.1 | internal | 113 | 3-341(+) |
Amino Acid sequence : | |||
| GWFYGNFGLDRGYVTGILTIDTVADFLPRKGPLRQRRKGIAYISNEAVRDRFRRKGIAKRLIANAEAQARTWGCRAIALHCDVSNEGATGLYKSQGFKCVNVPHGANWPQPRI | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,647.353 | ||
| Theoretical pI: | 10.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 18.153 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.239 | ||
| sheet | 0.195 | ||