| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB816948.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
| GIIAHVLSCRETNSHLRTLRFRANLGFTQLNALLRRALRQNVQHLDIEVGTSDHFSLPRSVVRSGSLKVLRLKSQYCGFRLPPSSVMSWGFKSLHTLSLSQVILYDRPSLEDMFTASAFP LLRRLSLDALFGLNCLK | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,495.900 | ||
| Theoretical pI: | 10.811 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.165 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.248 | ||
| sheet | 0.277 | ||