| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB816964.1 | internal | 101 | 3-305(+) |
Amino Acid sequence : | |||
| VNVGPKYQAIIPPWTGEASESDSRWLGTQIWPPQNLKNRSVVAHDSVGKGRIETCNCRVSSSVECIRFHTAENNIKLKKELGHAFYQWKFDTMGELVSLSW | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,460.859 | ||
| Theoretical pI: | 8.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 41.651 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.481 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.277 | ||
| sheet | 0.188 | ||