| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB816979.1 | internal | 148 | 2-445(+) |
Amino Acid sequence : | |||
| GCLQMQGLLLLGESTNLCSKLIDYVKRRPGHNNGAKDGIDGQFVVECELRAQGFRQGIESLQRSLQNVSSVLHEKSPLATSKSQGPNHEDDGLGPCNEEDQNSPGSELKAQMLLTSLLQE KLYSKNQEIEQLQAELATAVKGNDILRC | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,192.026 | ||
| Theoretical pI: | 5.203 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 61.201 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.277 | ||
| sheet | 0.297 | ||