Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817007.1 | 5prime_partial | 140 | 3-425(+) |
Amino Acid sequence : | |||
VIDMKGKAKSVSKRGDPKLGVKKGGRKAAKDPNKPKRPPSAFFVFMEEFRKQFKEKNPNNKSVAAVGKAAGAEWKNMTDEDKAPYVEKAEKRKRQYEKDMNVYNNKQDGVDVAEEESDKS KSEVNDEDDDDASGEEDDDE* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,761.200 | ||
Theoretical pI: | 5.507 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 39.889 | ||
aromaticity | 0.064 | ||
GRAVY | -1.494 | ||
Secondary Structure Fraction | |||
Helix | 0.157 | ||
turn | 0.236 | ||
sheet | 0.243 |