Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817008.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
GPFHFNVVVVSRSPAIRMGSENGAISTQKLRFLGLHGFRTNGEILRKQIGKWPEEVRQRLDLVFVDAPFPCQGKSDVQGIFDPPXYEWFQFHKEFTEYTNLNQCLEYIENCIIKYGPFDG LLGFSQGA | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,530.366 | ||
Theoretical pI: | 6.330 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 35.960 | ||
aromaticity | 0.142 | ||
GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.260 | ||
sheet | 0.189 |