| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817008.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| GPFHFNVVVVSRSPAIRMGSENGAISTQKLRFLGLHGFRTNGEILRKQIGKWPEEVRQRLDLVFVDAPFPCQGKSDVQGIFDPPXYEWFQFHKEFTEYTNLNQCLEYIENCIIKYGPFDG LLGFSQGA | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,530.366 | ||
| Theoretical pI: | 6.330 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 35.960 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.260 | ||
| sheet | 0.189 | ||