Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817029.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
GREICYLQTDVIFVSGGGGDTDQMAAQTVAVFDFDMTIIDCDSDDWVIENFGLVDRFKELLPLMPFNTVMDKMMEELWSRGKTVEDIASCLKNVPLHQSTVSAIKSAYASGCDLRIESDA NTFFIETILNHHGIRNCFSEINTNPGLVNPQGRLQVIPYHDFLTSPHGCNLCPPNMCKGKVIDRIKASFTDQAKRVIYVGDGKNDYCR | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 23,240.237 | ||
Theoretical pI: | 4.939 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18950 | ||
Instability index: | 42.530 | ||
aromaticity | 0.087 | ||
GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.231 | ||
sheet | 0.192 |