Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817036.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
VSTSVWMPVSRSQLFDFLRDNNLRGQWDILSNGGAMQEMVRISKNQDSPNCISLLCHPNXDGGGMIALQETWTDLISSVVVYAPIDVVTMTTVMSGGGDPNLVALLPSGFVITDGIMMED KE | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,369.637 | ||
Theoretical pI: | 9.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 63.474 | ||
aromaticity | 0.050 | ||
GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.281 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817036.1 | internal | 122 | 368-3(-) |
Amino Acid sequence : | |||
ASLSSIIIPSVITKPEGKRATKLGSPPPLITVVIVTTSIGAYTTTELIRSVHVSCNAIMPPPSXFGWQRRLMQLGESWFLLIRTISCMAPPLDRMSHCPLRLLSRRKSNSWLLDTGIQTE VE | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,369.637 | ||
Theoretical pI: | 9.915 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 63.474 | ||
aromaticity | 0.050 | ||
GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.281 | ||
sheet | 0.231 |