Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817044.1 | 5prime_partial | 156 | 3-473(+) |
Amino Acid sequence : | |||
DWPFPACFRFVVVVERTHKPWLSSKELVKGFSELPSYGEREKQREMEQITEGVNNISISDSNLKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAIATVVTIAEILKNNGLAV EKKIATSTVDINESGGRPVQKAKIEIVLGKPAMXAP* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 11,450.486 | ||
Theoretical pI: | 9.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 61.383 | ||
aromaticity | 0.130 | ||
GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.270 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817044.1 | 3prime_partial | 108 | 397-720(+) |
Amino Acid sequence : | |||
MNLVDVLFKRQRLRLCLASRRXXRPDXCCXCXXGKKGGXKXIHNFFLFCFLRLLPRPGLQCLWFGGPLFMFPCPARPTSFISLEEVWFSGVYSCTPKDPTSENVSLTS | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,450.486 | ||
Theoretical pI: | 9.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 61.383 | ||
aromaticity | 0.130 | ||
GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.270 | ||
sheet | 0.210 |