| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817044.1 | 5prime_partial | 156 | 3-473(+) |
Amino Acid sequence : | |||
| DWPFPACFRFVVVVERTHKPWLSSKELVKGFSELPSYGEREKQREMEQITEGVNNISISDSNLKKNRIQVSNTKKPLFFYVNLAKRYMQQHNEVELSALGMAIATVVTIAEILKNNGLAV EKKIATSTVDINESGGRPVQKAKIEIVLGKPAMXAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 11,450.486 | ||
| Theoretical pI: | 9.409 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 61.383 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.270 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817044.1 | 3prime_partial | 108 | 397-720(+) |
Amino Acid sequence : | |||
| MNLVDVLFKRQRLRLCLASRRXXRPDXCCXCXXGKKGGXKXIHNFFLFCFLRLLPRPGLQCLWFGGPLFMFPCPARPTSFISLEEVWFSGVYSCTPKDPTSENVSLTS | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,450.486 | ||
| Theoretical pI: | 9.409 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
| Instability index: | 61.383 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.074 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.270 | ||
| sheet | 0.210 | ||