| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817054.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
| ALDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKGPASSELPTPPPDNTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTM | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,501.906 | ||
| Theoretical pI: | 9.254 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 57.577 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.351 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.298 | ||
| sheet | 0.240 | ||