Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817054.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
ALDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKGPASSELPTPPPDNTEGIAWSMNQFRSFRWNLTASAARPNPQGSYHYGKINITRTM | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,501.906 | ||
Theoretical pI: | 9.254 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 57.577 | ||
aromaticity | 0.096 | ||
GRAVY | -0.351 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.298 | ||
sheet | 0.240 |