| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817072.1 | 5prime_partial | 130 | 471-79(-) |
Amino Acid sequence : | |||
| PCQLDILRHDSDTLGVDGAKVSVFEETNKVCLSGFLESQHSMALETQISLEILSNLTNKPLEWQLPDQKLGTLLVLTDFTESDSSGSASVRLLHSTGGWGRLTGSLGSQLLPGSLSSRRL TSGLLGTSHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,506.890 | ||
| Theoretical pI: | 10.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 38.611 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.519 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.132 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817072.1 | 3prime_partial | 129 | 85-471(+) |
Amino Acid sequence : | |||
| MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRCRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLAR | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,506.890 | ||
| Theoretical pI: | 10.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 38.611 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.519 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.132 | ||
| sheet | 0.295 | ||