Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817072.1 | 5prime_partial | 130 | 471-79(-) |
Amino Acid sequence : | |||
PCQLDILRHDSDTLGVDGAKVSVFEETNKVCLSGFLESQHSMALETQISLEILSNLTNKPLEWQLPDQKLGTLLVLTDFTESDSSGSASVRLLHSTGGWGRLTGSLGSQLLPGSLSSRRL TSGLLGTSHL* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,506.890 | ||
Theoretical pI: | 10.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 38.611 | ||
aromaticity | 0.047 | ||
GRAVY | -0.519 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.132 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817072.1 | 3prime_partial | 129 | 85-471(+) |
Amino Acid sequence : | |||
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRCRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLAR | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,506.890 | ||
Theoretical pI: | 10.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 38.611 | ||
aromaticity | 0.047 | ||
GRAVY | -0.519 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.132 | ||
sheet | 0.295 |