Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817084.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
GDSLLSLSSSHILIYPPHALIESQGKQTCCQQERSFSSLQTKKHSKSTGLWRACLRPSSTCSRMSRRRTLSHSPILLVRFLRRSSNIARCMWWWIVIPICLRMIEVLLKRLKNLTRNLCR LTRTHCSISSWLRTIWISRDFWH* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,849.706 | ||
Theoretical pI: | 11.356 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40490 | ||
Instability index: | 93.441 | ||
aromaticity | 0.077 | ||
GRAVY | -0.199 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.238 | ||
sheet | 0.203 |