| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817084.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
| GDSLLSLSSSHILIYPPHALIESQGKQTCCQQERSFSSLQTKKHSKSTGLWRACLRPSSTCSRMSRRRTLSHSPILLVRFLRRSSNIARCMWWWIVIPICLRMIEVLLKRLKNLTRNLCR LTRTHCSISSWLRTIWISRDFWH* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,849.706 | ||
| Theoretical pI: | 11.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40490 | ||
| Instability index: | 93.441 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.199 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.238 | ||
| sheet | 0.203 | ||