| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817085.1 | internal | 101 | 1-303(+) |
Amino Acid sequence : | |||
| GGGLSPSWILWIIFELWIVCKRYLMRDQCVTFYGPIQMTGVVGEFRLVAGYTFGQDIAAQFNHTHGLSLISRAHQLVMEGYNWCQEKNVVTVFSAPNYCYP | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,638.229 | ||
| Theoretical pI: | 9.104 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 35.093 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.238 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817085.1 | internal | 101 | 303-1(-) |
Amino Acid sequence : | |||
| WITVIWGTEYSHHIFLLAPVVAFHYQLVGPRNEGKSMGVVELSCYILSKSITSHEAKFPNHTGHLDRTIKGHTLVPHEVPLANDPKLEYYPKYPRWRKSTT | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,638.229 | ||
| Theoretical pI: | 9.104 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 35.093 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.238 | ||
| sheet | 0.198 | ||