Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817115.1	internal	125	2-376(+)
Amino Acid sequence :
IEFEDELKQEFLCPFCAEEFDIVGLFCHVEEDHPAEVKHGVCPVCVKRVGMDLVSHITMHHGNILKVQRKRRPRRGGSNSMFSILRKELRDASRQSLFGGTSYSLGSSNPEPDPLVSSLI YNSPV
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,084.948
Theoretical pI:		6.317
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3230
Instability index:		79.298
aromaticity		0.072
GRAVY		-0.318
Secondary Structure Fraction
Helix		0.296
turn		0.272
sheet		0.224