Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817122.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
GIKASFTDQAKRVIYVGDGKNDYCRRLKLTHEDYVMPRKNFPFRDLINANPMLVKGSVHEWSDRDDFERILTKSVSMNFVDEQKREVAPERLVGAAADCKEQKIVWFHQKSVMLFRFLGN CRKRNIPIFGPLGSWKLLSWV* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 16,491.930 | ||
Theoretical pI: | 9.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 22.578 | ||
aromaticity | 0.113 | ||
GRAVY | -0.457 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.206 | ||
sheet | 0.206 |