| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817133.1 | 5prime_partial | 109 | 349-20(-) |
Amino Acid sequence : | |||
| SVFLSARVDWKETPEDHVFKAVLPGIKKEEVKVEVEDGRVQKISGHRSRDKEEKINDTWHRIERRSGRFVRRFRLPENAKTEEVKALMENGVLTVIVPKVENNKKEASG* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,649.264 | ||
| Theoretical pI: | 9.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 47.733 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.886 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.193 | ||
| sheet | 0.239 | ||