Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817134.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
GDPPQDFSSDLTTNNLFSVFLSARVDWKETPEDHVFKAVLPGIKKEEVKVEVEDGRVQKISGHRSRDKEEKINDTWHRIERRSGRFVRRFRLPENAKTEEVKALMENGVLTVIVPKVENN KKEASG* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,499.167 | ||
Theoretical pI: | 8.179 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 46.965 | ||
aromaticity | 0.063 | ||
GRAVY | -0.881 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.222 | ||
sheet | 0.222 |