Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817148.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
GITWNSKDRDHSLRTPMLTRSLHYCLQHRRSHSQNARMCRDANTAGRENLNVGLREYTGKLIGEYGRRHYFASLKAFYRRIEYNYYCFPFLRRRRKESLLAEHGGQGVCPALYRQKRNKR EPKSLVERLERDSKEGRGRRVIHAFP | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 17,440.677 | ||
Theoretical pI: | 10.549 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 75.073 | ||
aromaticity | 0.103 | ||
GRAVY | -1.090 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.219 | ||
sheet | 0.233 |