Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817158.1 | 3prime_partial | 144 | 84-515(+) |
Amino Acid sequence : | |||
MLPTGKVVLKSSDKETFEIDKSVACLSQTIKYMLEDVSAENAIPLPNVTGSVLAKVIEYCKMHLVVDSNPNMSEDDRSTAEEVEKFDQEFVKVNQNTLFDLIMAANYLDIKGLLALTCRT AADSIKDLSVEDVRKIFNIENDFT | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,085.204 | ||
Theoretical pI: | 4.510 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 47.374 | ||
aromaticity | 0.063 | ||
GRAVY | -0.106 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.188 | ||
sheet | 0.285 |