Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817200.1 | 5prime_partial | 139 | 2-421(+) |
Amino Acid sequence : | |||
GGLINIRKRKKWRTLLLVWLCTTSASLSSWSLRQRGPSGSSSSRSMRKSSRLPLRGSAALMRPTRISPTACPMTSVVMPSTTXTSPPRSIARRARSSSLLGLQTHQRQGARCCMPALRTG SRGSWMEFRLNCRPLIPAR* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,939.880 | ||
Theoretical pI: | 6.141 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 42.145 | ||
aromaticity | 0.116 | ||
GRAVY | -0.578 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.174 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817200.1 | complete | 139 | 34-453(+) |
Amino Acid sequence : | |||
MANAASGMAVHDQCKLKFLELKAKRTFRFIIFKIDEKIQQVTVERVGSPDETYEDFANGLPNDECRYAVYDYXFTTEEHCQKSKIFFIAWSPDSSKTRSKMLYASSKDRFKRELDGIQVE LQATDPSEMSFDIVKGRAN* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,939.880 | ||
Theoretical pI: | 6.141 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 42.145 | ||
aromaticity | 0.116 | ||
GRAVY | -0.578 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.174 | ||
sheet | 0.239 |