| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817200.1 | 5prime_partial | 139 | 2-421(+) |
Amino Acid sequence : | |||
| GGLINIRKRKKWRTLLLVWLCTTSASLSSWSLRQRGPSGSSSSRSMRKSSRLPLRGSAALMRPTRISPTACPMTSVVMPSTTXTSPPRSIARRARSSSLLGLQTHQRQGARCCMPALRTG SRGSWMEFRLNCRPLIPAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,939.880 | ||
| Theoretical pI: | 6.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 42.145 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.578 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.174 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817200.1 | complete | 139 | 34-453(+) |
Amino Acid sequence : | |||
| MANAASGMAVHDQCKLKFLELKAKRTFRFIIFKIDEKIQQVTVERVGSPDETYEDFANGLPNDECRYAVYDYXFTTEEHCQKSKIFFIAWSPDSSKTRSKMLYASSKDRFKRELDGIQVE LQATDPSEMSFDIVKGRAN* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,939.880 | ||
| Theoretical pI: | 6.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 42.145 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.578 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.174 | ||
| sheet | 0.239 | ||