| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817221.1 | internal | 177 | 2-532(+) |
Amino Acid sequence : | |||
| GLCALFPLHLFFFFSDLISEKTHCAHYLRYSFTMAEHPGDSEVHQESLFDKVTEKLHARHDSSSPSSDDEKPLPAASAVHAGTGNSPPSSSSAPSSPSSIRSKIHRIFGREQPLHKVLGG GKSADIFLWRNKKKSGSVIGVATMIWFLFEVLEYHLLTLICYMMMASLAILLLWANA | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,587.266 | ||
| Theoretical pI: | 7.325 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 58.952 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.271 | ||
| sheet | 0.282 | ||