| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817223.1 | internal | 169 | 3-509(+) |
Amino Acid sequence : | |||
| GCRRGGRYPILSLPLGASIHLSGRWVERTSTIVYFALSNEGTMSSKRIQKELKDLQRDPPTSCSAGPVAEDVFHWQATIMGPVDSPYAGGVFVVNIHFPPDYPFKPPKVAFKTKVYHPNI NSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPEDPLVPEIAHMY | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,661.298 | ||
| Theoretical pI: | 7.856 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 54.691 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.302 | ||
| sheet | 0.201 | ||