| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817244.1 | internal | 134 | 404-3(-) |
Amino Acid sequence : | |||
| QSCMVTAQGRSDPNGPGVTVLQNCKIVGAPDYIPVKEKNKAYLGRPWKEYSRTIIMQSDISDVIAPEGWMPWQGNFALDTLFYAEFENRGPGANTAARVPWKGIKKLEGKAILPFTPEIL FKGSEWVVPTGAPS | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,372.801 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 55.729 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.568 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.306 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817244.1 | internal | 134 | 3-404(+) |
Amino Acid sequence : | |||
| GGSASRNNPLTPLKQNLGRKRQNSLTLQLLNPFPWNPSRCIGSRSTVLKLGIKQSVKSKVPLPRHPPLWRNNVTNIRLHDDRPRILLPRPPQVRLVLFLYGDVIRRTHNLTVLEHSNPRS VRIRAALCRDHARL | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,372.801 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 55.729 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.568 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.306 | ||
| sheet | 0.194 | ||