Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817244.1 | internal | 134 | 404-3(-) |
Amino Acid sequence : | |||
QSCMVTAQGRSDPNGPGVTVLQNCKIVGAPDYIPVKEKNKAYLGRPWKEYSRTIIMQSDISDVIAPEGWMPWQGNFALDTLFYAEFENRGPGANTAARVPWKGIKKLEGKAILPFTPEIL FKGSEWVVPTGAPS | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,372.801 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 55.729 | ||
aromaticity | 0.037 | ||
GRAVY | -0.568 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.306 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817244.1 | internal | 134 | 3-404(+) |
Amino Acid sequence : | |||
GGSASRNNPLTPLKQNLGRKRQNSLTLQLLNPFPWNPSRCIGSRSTVLKLGIKQSVKSKVPLPRHPPLWRNNVTNIRLHDDRPRILLPRPPQVRLVLFLYGDVIRRTHNLTVLEHSNPRS VRIRAALCRDHARL | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,372.801 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 55.729 | ||
aromaticity | 0.037 | ||
GRAVY | -0.568 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.306 | ||
sheet | 0.194 |