| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817251.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
| GHIRSGEGTPMMPKERIEVYIFALFQENKKTGFIAERNFGLFNPDFTPVYDAGIMRKDPLPLPGPKPGPVPVANKQWCIPXRTATKEQLQANLDFVCSQGLDCKPLQIGGHCFEPDTVLD HAAFAMNLWYQTKGHQDVNCDFSGTAQVVTRDPS | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,021.243 | ||
| Theoretical pI: | 6.074 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 38.451 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.255 | ||
| sheet | 0.203 | ||