Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817277.1 | internal | 181 | 2-544(+) |
Amino Acid sequence : | |||
AIRRIREWRKVNGHQPGMFSAPQSNHDNAPSPTNSFSRKKQKASQPMVSLSAAPSPALHLSMQPSSSTLKRGPPPGPRDKKPKQNYSSGLLGRAQITNYGNSGSFGANESAPSANFDLLI GRKVWTRWPEDNTFYEAVISNYDPIKGLHLLTYDIGTXNEAYEWVDIKEISPEDIRWASED | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,024.062 | ||
Theoretical pI: | 9.330 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
Instability index: | 51.791 | ||
aromaticity | 0.089 | ||
GRAVY | -0.827 | ||
Secondary Structure Fraction | |||
Helix | 0.233 | ||
turn | 0.350 | ||
sheet | 0.206 |