| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817277.1 | internal | 181 | 2-544(+) |
Amino Acid sequence : | |||
| AIRRIREWRKVNGHQPGMFSAPQSNHDNAPSPTNSFSRKKQKASQPMVSLSAAPSPALHLSMQPSSSTLKRGPPPGPRDKKPKQNYSSGLLGRAQITNYGNSGSFGANESAPSANFDLLI GRKVWTRWPEDNTFYEAVISNYDPIKGLHLLTYDIGTXNEAYEWVDIKEISPEDIRWASED | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,024.062 | ||
| Theoretical pI: | 9.330 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
| Instability index: | 51.791 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.827 | ||
Secondary Structure Fraction | |||
| Helix | 0.233 | ||
| turn | 0.350 | ||
| sheet | 0.206 | ||