Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817346.1	complete	114	197-541(+)
Amino Acid sequence :
MYLLLSLGLWSTLPEVVSIGRLTSTLVPILVDIHLGSTISSVPATRRLLLVSISTSGGLSSTSELPVFGGRIYHSTVMVLFCRRSRGLFPIPTHNFSRYLRAQATNYELVLVLP*
Physicochemical properties
Number of amino acids:		114
Molecular weight:		12,499.581
Theoretical pI:		10.383
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		54.968
aromaticity		0.079
GRAVY		0.575
Secondary Structure Fraction
Helix		0.421
turn		0.289
sheet		0.254