Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817372.1 | complete | 120 | 133-495(+) |
Amino Acid sequence : | |||
MAVPAGKVVLKSCDGETFEVDVAVASLAQTIKHMVEDVSLENAIPLPNVTGKILAKVIEYCKMHVETAQAEDRTVTEKELQNFDADFVKVDQNTLFDLILLGGQPFEHQGASGSYLPNCC * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,038.761 | ||
Theoretical pI: | 4.585 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 34.008 | ||
aromaticity | 0.058 | ||
GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.183 | ||
sheet | 0.292 |