Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817395.1	5prime_partial	157	542-69(-)
Amino Acid sequence :
HSCSHLLVIIFLAXGIIIILIIYLRLGLVRFLLSNIPTVLFVVVNIHVLLVLPLPLLSLLNIRSFIIVSHVFPLCPSGFPDRSNRLVVRILLLELLPELFHENEEGAGRPPRLVRVLGSL TPLLDTQLGISTLGDGLRLSLHVDELLGLGFASERKR*
Physicochemical properties
Number of amino acids:		157
Molecular weight:		15,261.602
Theoretical pI:		5.783
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		41.953
aromaticity		0.067
GRAVY		-1.618
Secondary Structure Fraction
Helix		0.141
turn		0.237
sheet		0.244

Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817395.1	complete	136	117-527(+)
Amino Acid sequence :
MKGKAKSVSKRGDPKLGVKKGRKAAKDPNKPRRPPSAFFVFMEEFRKQFKEKNPNNKSVAAVGKAAGAEWKNMTDDDKAPYVEKAEKRKRQYEKDMNVYNNKQDGGDVAEEESDKSKSEV NDEDDDDAXGEEDDDE*
Physicochemical properties
Number of amino acids:		136
Molecular weight:		15,261.602
Theoretical pI:		5.783
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		41.953
aromaticity		0.067
GRAVY		-1.618
Secondary Structure Fraction
Helix		0.141
turn		0.237
sheet		0.244