Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817400.1 | 3prime_partial | 111 | 19-351(+) |
Amino Acid sequence : | |||
MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIK | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,773.470 | ||
Theoretical pI: | 6.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 72.770 | ||
aromaticity | 0.091 | ||
GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.141 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817400.1 | 5prime_partial | 99 | 351-52(-) |
Amino Acid sequence : | |||
LDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,773.470 | ||
Theoretical pI: | 6.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 72.770 | ||
aromaticity | 0.091 | ||
GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.141 | ||
sheet | 0.202 |