| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817400.1 | 3prime_partial | 111 | 19-351(+) |
Amino Acid sequence : | |||
| MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIK | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,773.470 | ||
| Theoretical pI: | 6.765 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.770 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.404 | ||
| turn | 0.141 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817400.1 | 5prime_partial | 99 | 351-52(-) |
Amino Acid sequence : | |||
| LDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,773.470 | ||
| Theoretical pI: | 6.765 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.770 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.404 | ||
| turn | 0.141 | ||
| sheet | 0.202 | ||