Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817408.1 | internal | 119 | 3-359(+) |
Amino Acid sequence : | |||
NKLKRMALRVIAETLSEEEIAGLKEMFKAIDTDNSGQITFEELNEGLKKFGANLEESEIQDLMRAADVDNSGAIDYAEFIAAMLHLNKLDKEDHLFAAFSFFDKDGSDYXTIDELQQAC | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,270.692 | ||
Theoretical pI: | 4.343 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 41.688 | ||
aromaticity | 0.085 | ||
GRAVY | -0.357 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.153 | ||
sheet | 0.381 |