| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817408.1 | internal | 119 | 3-359(+) |
Amino Acid sequence : | |||
| NKLKRMALRVIAETLSEEEIAGLKEMFKAIDTDNSGQITFEELNEGLKKFGANLEESEIQDLMRAADVDNSGAIDYAEFIAAMLHLNKLDKEDHLFAAFSFFDKDGSDYXTIDELQQAC | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,270.692 | ||
| Theoretical pI: | 4.343 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 41.688 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.153 | ||
| sheet | 0.381 | ||