| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817427.1 | 3prime_partial | 146 | 84-521(+) |
Amino Acid sequence : | |||
| MLPTGKVVLKSSDKETFEIDKSVACLSQTIKYMLEDVSAENAIPLPNVTGSVLAKVIEYCKMHLVVDSNPNMSEDDRSTAEEVEKFDQEFVKVNQNTLFDLIMAANYLDIKGLLALTCRT AADSIKDLSVEDVRKIFNIENDFTAE | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,285.395 | ||
| Theoretical pI: | 4.510 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 46.862 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.185 | ||
| sheet | 0.295 | ||