| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817464.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
| ESTDKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWTCDISRDSMCLITGSADQTVKLWNVKTGSQIYTFNFDSPARSVEFSVGDKLAVITSDPF MDLTSAIHVKRIEKDPSEQSSESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIX | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,759.175 | ||
| Theoretical pI: | 7.151 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 39.640 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.254 | ||
| sheet | 0.198 | ||