Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817464.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
ESTDKMRPILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLGTYRGHNGAVWTCDISRDSMCLITGSADQTVKLWNVKTGSQIYTFNFDSPARSVEFSVGDKLAVITSDPF MDLTSAIHVKRIEKDPSEQSSESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIX | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,759.175 | ||
Theoretical pI: | 7.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 39.640 | ||
aromaticity | 0.079 | ||
GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.254 | ||
sheet | 0.198 |