| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817502.1 | 5prime_partial | 163 | 1-492(+) |
Amino Acid sequence : | |||
| GISSEEKRERERKKKERRSALSIFYRPEYFAPIAMAGASKSAPWLQSLRRYLKAPWEYTGPCASPEYLPAVPKATEYRVFCPATVPQRAIIPHANPENVFDIKYFSRDQRRNRPPIRRTF LKKADIEKMNMEKKSFEPSDFPIPYLTATVEEDYSAVGGGYQK* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 18,898.399 | ||
| Theoretical pI: | 9.641 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 71.717 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.809 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.239 | ||
| sheet | 0.252 | ||