| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817507.1 | internal | 101 | 1-303(+) |
Amino Acid sequence : | |||
| GHGCNLCPPNMCKGKIIDRIQASFTDQAKRMIYVGDGKNDYCPSLKLTHKDYVMPRKNFPFWELINANPILVKGSVHEWSDRDDFERILTKLISMNSVDDQ | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,630.252 | ||
| Theoretical pI: | 7.852 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 18.466 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.248 | ||
| sheet | 0.168 | ||