Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817507.1 | internal | 101 | 1-303(+) |
Amino Acid sequence : | |||
GHGCNLCPPNMCKGKIIDRIQASFTDQAKRMIYVGDGKNDYCPSLKLTHKDYVMPRKNFPFWELINANPILVKGSVHEWSDRDDFERILTKLISMNSVDDQ | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,630.252 | ||
Theoretical pI: | 7.852 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 18.466 | ||
aromaticity | 0.089 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.248 | ||
sheet | 0.168 |