Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817522.1	internal	153	1-459(+)
Amino Acid sequence :
GARTREICYIQTDLIFVSGGGGDTDQMAAQTVAVFDFDMTIIDCDSDDWVIENFGLVDRFKELLPLMPCNTLMDKMMEELWSRGKTVEDIASCLKNVPLHPSSISAIKSAYASGCDLRIV SDAXTFFIETILNHHGIRNCFSEINTNPGLVNP
Physicochemical properties
Number of amino acids:		153
Molecular weight:		16,827.014
Theoretical pI:		4.451
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14355
Instability index:		39.263
aromaticity		0.079
GRAVY		0.039
Secondary Structure Fraction
Helix		0.309
turn		0.230
sheet		0.230