Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817529.1	internal	157	2-472(+)
Amino Acid sequence :
GAMKGGGKRPIRALSLWMRRQPPKVKAFLAVVTGMASLVFLRMIVHDHDNLFVASEAVHAFGIIVLIYKLIKEKTCVGLSLKSQELTALFLAVRLYCSFMMEYDIHTVLDSATLATTLWV IYIIRFKLKSSYMEDKDNFATFFVVIPCAAAAAFIHP
Physicochemical properties
Number of amino acids:		157
Molecular weight:		17,601.890
Theoretical pI:		9.483
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		28.941
aromaticity		0.115
GRAVY		0.576
Secondary Structure Fraction
Helix		0.395
turn		0.146
sheet		0.306