Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817533.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
GDLKATNFEILAATIWRCRAIAQHTADPQQEVRLLIPVNMRSKFDPPLNAGYYGNAFFSGTAISTVEKLTSSPLLYALETVXKAKADSSKEYMKSVADLMVIRGRPHVAVVGTLVLTDWS RLGLDEVDYGWGKPVYGGPAKVGVGAIPGILGFFSSCEAGEG | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,264.617 | ||
Theoretical pI: | 6.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 26.958 | ||
aromaticity | 0.093 | ||
GRAVY | 0.060 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.255 | ||
sheet | 0.267 |