Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817538.1 | 3prime_partial | 144 | 83-514(+) |
Amino Acid sequence : | |||
MLPTGKVVLKSSDKETFEIDKSVACLSQTIKYMLEDVSAENAIPLPNVTGSVLAKVIEYCKMHLVVDSNPNMSEYDRSTAEEVEKFDQEFVKVNQNTLFDLIMAANYLDIKGLLALTCRT AADSIKDLSVEDVRKIFNIENDFT | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,133.289 | ||
Theoretical pI: | 4.570 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 47.681 | ||
aromaticity | 0.069 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.188 | ||
sheet | 0.285 |