| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817547.1 | 3prime_partial | 130 | 84-473(+) |
Amino Acid sequence : | |||
| MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLSV | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,699.496 | ||
| Theoretical pI: | 6.763 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 65.920 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.195 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817547.1 | 5prime_partial | 118 | 473-117(-) |
Amino Acid sequence : | |||
| DGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,699.496 | ||
| Theoretical pI: | 6.763 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 65.920 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.195 | ||
| sheet | 0.178 | ||