| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817553.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
| EELDASVSNGDEGDWITIQEFLIENPSPQKSSVFLSIGGMRLYTKDITSGGSDDETDKELCVEGSSSDDSDGGSDDSVESGSDIDDEIVADYMEGIGRSGEIFDTKWLAKLDMDASRDID HGDGELLKELGGVALEEASREHRVAKVIKLQKKQSVTSKSPIGPNYMWSSAMDDLVLV | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,256.796 | ||
| Theoretical pI: | 4.111 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 43.556 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.275 | ||
| sheet | 0.247 | ||