Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817600.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
GKNKVNMDFQSFVNRVNDLWGQPQFKDLDLEFDQPIRELGFHGVPHKTTAFVVPTSSCLVELIETPFVVITLGEIEIVNLERVGFGQKNFDMTIVFKDSXRDVFRIDSIPTSSLEGIKDW LDTTDIKYYKSRLNLNWRPILKT* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 12,904.796 | ||
Theoretical pI: | 10.529 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 44.480 | ||
aromaticity | 0.095 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.353 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817600.1 | 3prime_partial | 117 | 351-1(-) |
Amino Acid sequence : | |||
MPSSELVGIESILNTSRXESLNTMVISKFFCPNPTLSRLTISISPRVITTNGVSISSTRQLDVGTTNAVVLCGTPWKPNSLIGWSNSKSRSLNCGWPQRSFTRFTKLWKSMFTLFFP | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,904.796 | ||
Theoretical pI: | 10.529 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 44.480 | ||
aromaticity | 0.095 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.353 | ||
sheet | 0.155 |