Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817605.1 | internal | 144 | 2-433(+) |
Amino Acid sequence : | |||
GCALFPLHLFFFFSDLISEKTHCAHYLRYSFTMAEHPGDSEVHQESLFDKVTEKLHARHDSSSSSSDDEKPLPAASAVHAGTGNSPPSSSSAPSSPSSIRSKIHRIFGREQPLHKVLGGG KSADIFLWRNKKKSGSVIGVATMI | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 13,293.681 | ||
Theoretical pI: | 4.497 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 76.146 | ||
aromaticity | 0.092 | ||
GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.269 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817605.1 | 5prime_partial | 119 | 435-76(-) |
Amino Acid sequence : | |||
QIIVATPITLPDFFLFLHRKISADLPPPRTLCRGCSRPKMRWILERMEDGEEGADDEEGGEFPVPACTADAAGSGFSSSEEEEEESWRAWSFSVTLSKRDSWCTSESPGCSAMVNEYLR* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,293.681 | ||
Theoretical pI: | 4.497 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 76.146 | ||
aromaticity | 0.092 | ||
GRAVY | -0.474 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.269 | ||
sheet | 0.294 |