Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817618.1 | internal | 158 | 1-474(+) |
Amino Acid sequence : | |||
VALTGHTANNKLGMMACRPAPVQVTWIGYPNTTGLPTIDYRISDALADPWNSSQKNVEELIRLPESFLCYTPSPEAGEVFPAPALSNGFVTFGSFNNLAKITPKVLRIWARILCAVPNFR LMVKCKPFCCDSIRLRFLSTLEQLGVDPARVDLLPLIL | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 17,448.261 | ||
Theoretical pI: | 8.603 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
Instability index: | 39.715 | ||
aromaticity | 0.089 | ||
GRAVY | 0.191 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.259 | ||
sheet | 0.266 |