| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817644.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
| GHFKLNPSPQRYSKRGERKSKRKQMSKKDEQPVLGIPYPVHQGPAPAPAYYVGVNPHQAGAIPPFAIVGDPKGVPIQQTIYRDTPAPFNCQHCGNSGLTDVQSKPSLAAVVGCMMXMMLG VCFLCPSMDCLWHKYHHCPSCGQKVADFEKSDPCAVMDPPHWIMESFALPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,658.494 | ||
| Theoretical pI: | 8.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20440 | ||
| Instability index: | 51.284 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.359 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.294 | ||
| sheet | 0.194 | ||